Lineage for d2ojzi_ (2ojz I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744656Domain d2ojzi_: 2ojz I: [139121]
    Other proteins in same PDB: d2ojzl1, d2ojzl2, d2ojzm1, d2ojzm2
    automated match to d6shgh_

Details for d2ojzi_

PDB Entry: 2ojz (more details), 2.73 Å

PDB Description: Anti-DNA antibody ED10
PDB Compounds: (I:) Fab ED10 heavy chain

SCOPe Domain Sequences for d2ojzi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojzi_ b.1.1.1 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqleesgpelvkpgasvkisckasgytftdyymnwlrqkpgqglewigwvypgsikyne
kfkdkatltadtsssivymhlssltsddnavyfctrwtygssfdywgegtlltvssaktt
ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d2ojzi_:

Click to download the PDB-style file with coordinates for d2ojzi_.
(The format of our PDB-style files is described here.)

Timeline for d2ojzi_: