Lineage for d2oaca1 (2oac A:79-209)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326363Protein Class pi GST [81347] (4 species)
  7. 2326513Species Mouse (Mus musculus) [TaxId:10090] [47621] (10 PDB entries)
  8. 2326528Domain d2oaca1: 2oac A:79-209 [138965]
    Other proteins in same PDB: d2oaca2, d2oacb2
    automated match to d1gssa1
    complexed with gtb; mutant

Details for d2oaca1

PDB Entry: 2oac (more details), 2.2 Å

PDB Description: mouse c14a glutathione-s-transferase mutant in complex with s-(p- nitrobenzyl) glutathione
PDB Compounds: (A:) Glutathione S-transferase P 1

SCOPe Domain Sequences for d2oaca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oaca1 a.45.1.1 (A:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOPe Domain Coordinates for d2oaca1:

Click to download the PDB-style file with coordinates for d2oaca1.
(The format of our PDB-style files is described here.)

Timeline for d2oaca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oaca2