Lineage for d2o23b2 (2o23 B:1-261)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2451247Protein automated matches [190085] (58 species)
    not a true protein
  7. 2451497Species Human (Homo sapiens) [TaxId:9606] [186828] (33 PDB entries)
  8. 2451499Domain d2o23b2: 2o23 B:1-261 [138885]
    Other proteins in same PDB: d2o23a3, d2o23b3
    automated match to d1u7ta_
    complexed with gol, nad

Details for d2o23b2

PDB Entry: 2o23 (more details), 1.2 Å

PDB Description: the structure of wild-type human hadh2 (17beta-hydroxysteroid dehydrogenase type 10) bound to nad+ at 1.2 a
PDB Compounds: (B:) HADH2 protein

SCOPe Domain Sequences for d2o23b2:

Sequence, based on SEQRES records: (download)

>d2o23b2 c.2.1.2 (B:1-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maaacrsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvf
apadvtsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldv
nlmgtfnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
piardlapigirvmtiapglfgtplltslpekvcnflasqvpfpsrlgdpaeyahlvqai
ienpflngevirldgairmqp

Sequence, based on observed residues (ATOM records): (download)

>d2o23b2 c.2.1.2 (B:1-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maaacrsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvf
apadvtsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldv
nlmgtfnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
piardlapigirvmtiapglfgtpllnflasqvpfpsrlgdpaeyahlvqaiienpflng
evirldgairmqp

SCOPe Domain Coordinates for d2o23b2:

Click to download the PDB-style file with coordinates for d2o23b2.
(The format of our PDB-style files is described here.)

Timeline for d2o23b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o23b3