Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
Domain d2nz9c2: 2nz9 C:115-215 [138841] Other proteins in same PDB: d2nz9c1, d2nz9d1, d2nz9d2, d2nz9d3, d2nz9e1, d2nz9f1, d2nz9f2, d2nz9f3 automatically matched to d1egjl2 complexed with ca, zn |
PDB Entry: 2nz9 (more details), 3.79 Å
SCOPe Domain Sequences for d2nz9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nz9c2 b.1.1.2 (C:115-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} aapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskd styslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d2nz9c2: