Lineage for d2nyyc1 (2nyy C:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758606Domain d2nyyc1: 2nyy C:1-111 [138829]
    Other proteins in same PDB: d2nyya1, d2nyya2, d2nyya3, d2nyya4, d2nyyc2, d2nyyd1, d2nyyd2, d2nyyd3
    automated match to d1n0xl1
    complexed with ca, zn

Details for d2nyyc1

PDB Entry: 2nyy (more details), 2.61 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody cr1
PDB Compounds: (C:) CR1 monoclonal antibody

SCOPe Domain Sequences for d2nyyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nyyc1 b.1.1.0 (C:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratiscrasesvdsyghsfmqwyqqkpgqaprlliyrasnlep
giparfsgsgsgtdftltisslepedfavyycqqgnevpftfgqgtkveik

SCOPe Domain Coordinates for d2nyyc1:

Click to download the PDB-style file with coordinates for d2nyyc1.
(The format of our PDB-style files is described here.)

Timeline for d2nyyc1: