![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Superfamily a.118.1: ARM repeat [48371] (26 families) ![]() |
![]() | Family a.118.1.20: B56-like [140819] (1 protein) Pfam PF01603; Protein phosphatase 2A regulatory B subunit family |
![]() | Protein Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma [140820] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140821] (4 PDB entries) Uniprot Q13362 30-372! Uniprot Q13362 38-425 |
![]() | Domain d2nylb1: 2nyl B:28-415 [138816] Other proteins in same PDB: d2nyla1, d2nylc1, d2nyld1, d2nylf1 complexed with mn |
PDB Entry: 2nyl (more details), 3.8 Å
SCOPe Domain Sequences for d2nylb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nylb1 a.118.1.20 (B:28-415) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]} qeklfiqklrqccvlfdfvsdplsdlkwkevkraalsemveyithnrnvitepiypevvh mfavnmfrtlppssnptgaefdpeedeptleaawphlqlvyefflrflespdfqpniakk yidqkfvlqllelfdsedprerdflkttlhriygkflglrayirkqinnifyrfiyeteh hngiaelleilgsiingfalplkeehkifllkvllplhkvkslsvyhpqlaycvvqflek dstltepvvmallkywpkthspkevmflneleeildviepsefvkimeplfrqlakcvss phfqvaeralyywnneyimslisdnaakilpimfpslyrnskthwnktihgliynalklf memnqklfddctqqfkaeklkeklkmke
Timeline for d2nylb1: