Lineage for d2nvzi2 (2nvz I:50-120)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464070Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 1464071Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)
  6. 1464072Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
    contains two differently decorated domains of this fold
  7. 1464073Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
    Uniprot P27999; part of multichain biological unit
  8. 1464121Domain d2nvzi2: 2nvz I:50-120 [138702]
    Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc1, d2nvzc2, d2nvze1, d2nvze2, d2nvzf1, d2nvzh1, d2nvzj1, d2nvzk1, d2nvzl1
    automatically matched to d1i3qi2
    protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn

Details for d2nvzi2

PDB Entry: 2nvz (more details), 4.3 Å

PDB Description: rna polymerase ii elongation complex with utp, updated 11/2006
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOPe Domain Sequences for d2nvzi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvzi2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

SCOPe Domain Coordinates for d2nvzi2:

Click to download the PDB-style file with coordinates for d2nvzi2.
(The format of our PDB-style files is described here.)

Timeline for d2nvzi2: