Lineage for d2nvye1 (2nvy E:2-143)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604746Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 1604747Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)
  6. 1604748Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)
  7. 1604749Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (26 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 1604763Domain d2nvye1: 2nvy E:2-143 [138684]
    Other proteins in same PDB: d2nvya1, d2nvyb1, d2nvyc1, d2nvyc2, d2nvye2, d2nvyf1, d2nvyh1, d2nvyi1, d2nvyi2, d2nvyj1, d2nvyk1, d2nvyl1
    automatically matched to d1i3qe1
    protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d2nvye1

PDB Entry: 2nvy (more details), 3.4 Å

PDB Description: RNA Polymerase II form II in 150 mM Mn+2
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2nvye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvye1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

SCOPe Domain Coordinates for d2nvye1:

Click to download the PDB-style file with coordinates for d2nvye1.
(The format of our PDB-style files is described here.)

Timeline for d2nvye1: