Lineage for d2nvxi2 (2nvx I:50-120)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705857Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 1705858Family g.41.3.1: Transcriptional factor domain [57784] (5 proteins)
  6. 1705859Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
    contains two differently decorated domains of this fold
  7. 1705860Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
    Uniprot P27999; part of multichain biological unit
  8. 1705894Domain d2nvxi2: 2nvx I:50-120 [138676]
    Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc1, d2nvxc2, d2nvxe1, d2nvxe2, d2nvxf1, d2nvxh1, d2nvxj1, d2nvxk1, d2nvxl1
    automatically matched to d1i3qi2
    protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvxi2

PDB Entry: 2nvx (more details), 3.6 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dUTP
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOPe Domain Sequences for d2nvxi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvxi2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

SCOPe Domain Coordinates for d2nvxi2:

Click to download the PDB-style file with coordinates for d2nvxi2.
(The format of our PDB-style files is described here.)

Timeline for d2nvxi2: