Class a: All alpha proteins [46456] (284 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.2: RPB6 [55294] (1 protein) |
Protein RPB6 [55295] (3 species) essential subunit of RNA polymerases I, II and III |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (30 PDB entries) Uniprot P20435; part of multichain biological unit |
Domain d2nvtf1: 2nvt F:72-155 [138653] Other proteins in same PDB: d2nvta1, d2nvtb1, d2nvtc1, d2nvtc2, d2nvte1, d2nvte2, d2nvth1, d2nvti1, d2nvti2, d2nvtj1, d2nvtk1, d2nvtl1 automatically matched to d1i3qf_ protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn |
PDB Entry: 2nvt (more details), 3.36 Å
SCOPe Domain Sequences for d2nvtf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvtf1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip lvirrylpdgsfedwsveelivdl
Timeline for d2nvtf1: