![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
![]() | Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
![]() | Protein RPB3 [64315] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries) Uniprot P16370; part of multichain biological unit |
![]() | Domain d2nvtc1: 2nvt C:3-37,C:173-268 [138649] Other proteins in same PDB: d2nvta1, d2nvtb1, d2nvtc2, d2nvte1, d2nvte2, d2nvtf1, d2nvth1, d2nvti1, d2nvti2, d2nvtj1, d2nvtk1, d2nvtl1 automatically matched to d1i3qc1 protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn |
PDB Entry: 2nvt (more details), 3.36 Å
SCOPe Domain Sequences for d2nvtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvtc1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva sillaltqmdqd
Timeline for d2nvtc1: