![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
![]() | Family d.74.3.2: RBP11/RpoL [64311] (3 proteins) |
![]() | Protein automated matches [190337] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187160] (5 PDB entries) |
![]() | Domain d2nvqk_: 2nvq K: [138645] Other proteins in same PDB: d2nvqa_, d2nvqb_, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqf_, d2nvqh_, d2nvqi1, d2nvqi2, d2nvqj_, d2nvql_ automated match to d1i3qk_ protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn |
PDB Entry: 2nvq (more details), 2.9 Å
SCOPe Domain Sequences for d2nvqk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvqk_ d.74.3.2 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d2nvqk_: