Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins) |
Protein RPB3 [64315] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries) Uniprot P16370; part of multichain biological unit |
Domain d2nvqc1: 2nvq C:3-41,C:173-268 [138636] Other proteins in same PDB: d2nvqa_, d2nvqb_, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqf_, d2nvqh_, d2nvqi1, d2nvqi2, d2nvqj_, d2nvqk_, d2nvql_ automated match to d1twfc1 protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn |
PDB Entry: 2nvq (more details), 2.9 Å
SCOPe Domain Sequences for d2nvqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvqc1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq kkvasillaltqmdqd
Timeline for d2nvqc1: