Lineage for d2nppb1 (2npp B:28-415)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1500999Family a.118.1.20: B56-like [140819] (1 protein)
    Pfam PF01603; Protein phosphatase 2A regulatory B subunit family
  6. 1501000Protein Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma [140820] (1 species)
  7. 1501001Species Human (Homo sapiens) [TaxId:9606] [140821] (4 PDB entries)
    Uniprot Q13362 30-372! Uniprot Q13362 38-425
  8. 1501003Domain d2nppb1: 2npp B:28-415 [138445]
    Other proteins in same PDB: d2nppa1, d2nppc1, d2nppd1, d2nppf1
    complexed with mn

Details for d2nppb1

PDB Entry: 2npp (more details), 3.3 Å

PDB Description: Structure of the Protein Phosphatase 2A Holoenzyme
PDB Compounds: (B:) serine/threonine-protein phosphatase 2a 56 kda regulatory subunit gamma isoform

SCOPe Domain Sequences for d2nppb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nppb1 a.118.1.20 (B:28-415) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]}
qeklfiqklrqccvlfdfvsdplsdlkwkevkraalsemveyithnrnvitepiypevvh
mfavnmfrtlppssnptgaefdpeedeptleaawphlqlvyefflrflespdfqpniakk
yidqkfvlqllelfdsedprerdflkttlhriygkflglrayirkqinnifyrfiyeteh
hngiaelleilgsiingfalplkeehkifllkvllplhkvkslsvyhpqlaycvvqflek
dstltepvvmallkywpkthspkevmflneleeildviepsefvkimeplfrqlakcvss
phfqvaeralyywnneyimslisdnaakilpimfpslyrnskthwnktihgliynalklf
memnqklfddctqqfkaeklkeklkmke

SCOPe Domain Coordinates for d2nppb1:

Click to download the PDB-style file with coordinates for d2nppb1.
(The format of our PDB-style files is described here.)

Timeline for d2nppb1: