Lineage for d2jdie3 (2jdi E:82-357)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696819Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (16 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 696917Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)
  7. 696957Species Rat (Rattus norvegicus) [TaxId:10116] [88781] (4 PDB entries)
  8. 696959Domain d2jdie3: 2jdi E:82-357 [138268]
    Other proteins in same PDB: d2jdid1, d2jdid2, d2jdie1, d2jdie2, d2jdif1, d2jdif2, d2jdig1, d2jdih1, d2jdih2
    automatically matched to d1mabb3
    complexed with anp, mg

Details for d2jdie3

PDB Entry: 2jdi (more details), 1.9 Å

PDB Description: ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
PDB Compounds: (E:) ATP synthase subunit beta

SCOP Domain Sequences for d2jdie3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdie3 c.37.1.11 (E:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOP Domain Coordinates for d2jdie3:

Click to download the PDB-style file with coordinates for d2jdie3.
(The format of our PDB-style files is described here.)

Timeline for d2jdie3: