Lineage for d2ja7u1 (2ja7 U:2-49)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641064Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. 2641065Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)
  6. 2641066Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
    contains two differently decorated domains of this fold
  7. 2641067Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
    Uniprot P27999; part of multichain biological unit
  8. 2641106Domain d2ja7u1: 2ja7 U:2-49 [138217]
    Other proteins in same PDB: d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7j1, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7s1, d2ja7s2, d2ja7t1, d2ja7v1, d2ja7w1, d2ja7x1
    automatically matched to d1i3qi1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja7u1

PDB Entry: 2ja7 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex c
PDB Compounds: (U:) DNA-directed RNA polymerase II subunit 9

SCOPe Domain Sequences for d2ja7u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja7u1 g.41.3.1 (U:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOPe Domain Coordinates for d2ja7u1:

Click to download the PDB-style file with coordinates for d2ja7u1.
(The format of our PDB-style files is described here.)

Timeline for d2ja7u1: