Lineage for d2ja5e1 (2ja5 E:2-143)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490853Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 2490854Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)
  6. 2490855Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)
  7. 2490856Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2490878Domain d2ja5e1: 2ja5 E:2-143 [138163]
    Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e2, d2ja5f1, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1
    automatically matched to d1i3qe1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja5e1

PDB Entry: 2ja5 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex a
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d2ja5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja5e1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

SCOPe Domain Coordinates for d2ja5e1:

Click to download the PDB-style file with coordinates for d2ja5e1.
(The format of our PDB-style files is described here.)

Timeline for d2ja5e1: