![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) ![]() |
![]() | Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins) |
![]() | Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (26 PDB entries) Uniprot P20434; part of multichain biological unit |
![]() | Domain d2ja5e1: 2ja5 E:2-143 [138163] Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e2, d2ja5f1, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1 automatically matched to d1i3qe1 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2ja5 (more details), 3.8 Å
SCOPe Domain Sequences for d2ja5e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja5e1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam klvpsippatietfneaalvvn
Timeline for d2ja5e1: