Lineage for d2j6eb1 (2j6e B:238-339)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752084Domain d2j6eb1: 2j6e B:238-339 [138082]
    Other proteins in same PDB: d2j6eh1, d2j6eh2, d2j6ei1, d2j6ei2, d2j6el1, d2j6el2, d2j6em1
    automated match to d1hzhh3
    complexed with act, cac, cd, mpd, zn

Details for d2j6eb1

PDB Entry: 2j6e (more details), 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d2j6eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6eb1 b.1.1.2 (B:238-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvsheepevkfnwyvdgvevhnaktkpreeqyn
styrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d2j6eb1:

Click to download the PDB-style file with coordinates for d2j6eb1.
(The format of our PDB-style files is described here.)

Timeline for d2j6eb1: