Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries) |
Domain d2j5wa5: 2j5w A:890-1041 [138071] automated match to d2j5wa5 complexed with ca, cu, gol, na, nag, o, oxy |
PDB Entry: 2j5w (more details), 2.8 Å
SCOPe Domain Sequences for d2j5wa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5wa5 b.6.1.0 (A:890-1041) automated matches {Human (Homo sapiens) [TaxId: 9606]} nprrklefallflvfdeneswylddniktysdhpekvnkddeefiesnkmhaingrmfgn lqgltmhvgdevnwylmgmgneidlhtvhfhghsfqykhrgvyssdvfdifpgtyqtlem fprtpgiwllhchvtdhihagmettytvlqne
Timeline for d2j5wa5: