| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
| Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
| Protein Ribosomal protein S3 N-terminal domain [54816] (4 species) |
| Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries) Uniprot P80372 |
| Domain d2j00c1: 2j00 C:2-106 [137839] Other proteins in same PDB: d2j00b1, d2j00c2, d2j00d1, d2j00e1, d2j00e2, d2j00f1, d2j00g1, d2j00h1, d2j00i1, d2j00j1, d2j00k1, d2j00l1, d2j00m1, d2j00n1, d2j00o1, d2j00p1, d2j00q1, d2j00r1, d2j00s1, d2j00t1, d2j00u1 protein/RNA complex; complexed with mg, par, zn protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 2j00 (more details), 2.8 Å
SCOPe Domain Sequences for d2j00c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j00c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d2j00c1: