Lineage for d2iyrb_ (2iyr B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362551Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. 1362584Protein automated matches [190331] (1 species)
    not a true protein
  7. 1362585Species Mycobacterium tuberculosis [TaxId:83332] [187153] (10 PDB entries)
  8. 1362595Domain d2iyrb_: 2iyr B: [137808]
    automated match to d1l4ua_
    complexed with skm

Details for d2iyrb_

PDB Entry: 2iyr (more details), 1.98 Å

PDB Description: shikimate kinase from mycobacterium tuberculosis in complex with shikimate
PDB Compounds: (B:) Shikimate kinase

SCOPe Domain Sequences for d2iyrb_:

Sequence, based on SEQRES records: (download)

>d2iyrb_ c.37.1.2 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvps

Sequence, based on observed residues (ATOM records): (download)

>d2iyrb_ c.37.1.2 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvllagp
draekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvps

SCOPe Domain Coordinates for d2iyrb_:

Click to download the PDB-style file with coordinates for d2iyrb_.
(The format of our PDB-style files is described here.)

Timeline for d2iyrb_: