Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (9 proteins) |
Protein Beta-ketoacyl-ACP synthase II [53909] (6 species) |
Species Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId:3702] [117749] (2 PDB entries) Uniprot Q8L3X9 |
Domain d2ix4a2: 2ix4 A:301-461 [137760] automated match to d1w0ia2 complexed with 6na, k |
PDB Entry: 2ix4 (more details), 1.95 Å
SCOPe Domain Sequences for d2ix4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} yaelcgygmsgdahhitqppedgkgavlamtralrqsglcpnqidyvnahatstpigdav earaiktvfsehatsgtlafsstkgatghllgaagaveaifsilaihhgvapmtlnvknp dpifdkrfmplttskkmlvrtamsnsfgfggtnasllfasi
Timeline for d2ix4a2: