| Root: SCOPe 2.08 |
| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) ![]() Pfam PF00520 |
| Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
| Protein Potassium channel protein [56901] (3 species) |
| Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries) |
| Domain d2itdc_: 2itd C: [137639] Other proteins in same PDB: d2itda1, d2itda2, d2itda3, d2itdb1, d2itdb2 automated match to d1r3jc_ complexed with ba |
PDB Entry: 2itd (more details), 2.7 Å
SCOPe Domain Sequences for d2itdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2itdc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2itdc_: