Lineage for d2icwh1 (2icw H:1-213)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650991Fold a.202: Superantigen MAM [101343] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 650992Superfamily a.202.1: Superantigen MAM [101344] (1 family) (S)
  5. 650993Family a.202.1.1: Superantigen MAM [101345] (1 protein)
  6. 650994Protein Superantigen MAM [101346] (1 species)
  7. 650995Species Mycoplasma arthritidis [TaxId:2111] [101347] (3 PDB entries)
  8. 650997Domain d2icwh1: 2icw H:1-213 [137252]
    Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwb2, d2icwd1, d2icwd2, d2icwe1, d2icwe2
    automatically matched to d1r5id_
    mutant

Details for d2icwh1

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
PDB Compounds: (H:) Mycoplasma arthritidis mitogen

SCOP Domain Sequences for d2icwh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icwh1 a.202.1.1 (H:1-213) Superantigen MAM {Mycoplasma arthritidis [TaxId: 2111]}
mklrvenpkkaqkhfvqnlnnvvftnkelediynlsnkeetkevlklfklkvnqfyrhaf
givndynglleykeifnmmflklsvvfdtqrkeannveqikrniaildeimakadndlsy
fisqnknfqelwdkavkltkemkiklkgqkldlrdgevainkvrelfgsdknvkelwwfr
sllvkgvylikryyegdielkttsdfakavfed

SCOP Domain Coordinates for d2icwh1:

Click to download the PDB-style file with coordinates for d2icwh1.
(The format of our PDB-style files is described here.)

Timeline for d2icwh1: