SCOP 1.73: Domain d2icwb2: 2icw B:1-92

Lineage for d2icwb2 (2icw B:1-92)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (12 PDB entries)

8. Domain d2icwb2: 2icw B:1-92 [137246]
   Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwd1, d2icwd2, d2icwe1, d2icwg1, d2icwh1
   automatically matched to d1d5xb2
   mutant

Details for d2icwb2

PDB Entry: 2icw, 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d2icwb2:

Sequence; same for both SEQRES and ATOM records:

>d2icwb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d2icwb2:

• d2icwb2 is new in SCOP 1.73
  
• d2icwb2 appears in SCOP 1.75
  
• d2icwb2 appears in the current release, SCOPe 2.08