SCOPe 2.08: Domain d2i9tb1: 2i9t B:551-650

Lineage for d2i9tb1 (2i9t B:551-650)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries)

8. Domain d2i9tb1: 2i9t B:551-650 [137131]
   Other proteins in same PDB: d2i9ta1, d2i9ta2, d2i9ta3, d2i9tb2
   automated match to d1leib1
   protein/DNA complex

Details for d2i9tb1

PDB Entry: 2i9t, 2.8 Å

PDB Description: structure of nf-kb p65-p50 heterodimer bound to prdii element of b- interferon promoter

PDB Compounds: (B:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d2i9tb1:

Sequence; same for both SEQRES and ATOM records:

>d2i9tb1 b.1.18.1 (B:551-650) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Timeline for d2i9tb1:

• d2i9tb1 first appeared in SCOP 1.73
  
• d2i9tb1 appears in SCOPe 2.07