Lineage for d2hhhs1 (2hhh S:2-81)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720813Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 720814Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 720815Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 720816Protein Ribosomal protein S19 [54572] (1 species)
  7. 720817Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
  8. 720837Domain d2hhhs1: 2hhh S:2-81 [136495]
    Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhht1
    automatically matched to d1fjgs_
    complexed with ksg

Details for d2hhhs1

PDB Entry: 2hhh (more details), 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit
PDB Compounds: (S:) 30S ribosomal protein S19

SCOP Domain Sequences for d2hhhs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhhs1 d.28.1.1 (S:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d2hhhs1:

Click to download the PDB-style file with coordinates for d2hhhs1.
(The format of our PDB-style files is described here.)

Timeline for d2hhhs1: