Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (4 species) |
Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries) Uniprot P24319 |
Domain d2hhhh1: 2hhh H:1-138 [136484] Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1 automatically matched to d1fjgh_ complexed with ksg |
PDB Entry: 2hhh (more details), 3.35 Å
SCOP Domain Sequences for d2hhhh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhhh1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]} mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt drearklgvggelicevw
Timeline for d2hhhh1: