Class a: All alpha proteins [46456] (290 folds) |
Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) |
Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
Protein Ribosomal protein S7 [47975] (4 species) |
Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries) Uniprot P17291 |
Domain d2hhhg1: 2hhh G:2-156 [136483] Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1 automatically matched to d1fjgg_ complexed with ksg |
PDB Entry: 2hhh (more details), 3.35 Å
SCOPe Domain Sequences for d2hhhg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhhg1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]} arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria helmdaaegkggavkkkedvermaeanrayahyrw
Timeline for d2hhhg1: