Lineage for d2hhhf1 (2hhh F:1-101)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953643Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 2953644Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 2953645Protein Ribosomal protein S6 [54997] (4 species)
  7. 2953675Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 2953704Domain d2hhhf1: 2hhh F:1-101 [136482]
    Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1
    automatically matched to d1fjgf_
    complexed with ksg

Details for d2hhhf1

PDB Entry: 2hhh (more details), 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2hhhf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhhf1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d2hhhf1:

Click to download the PDB-style file with coordinates for d2hhhf1.
(The format of our PDB-style files is described here.)

Timeline for d2hhhf1: