| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
| Protein Ribosomal protein S17 [50304] (3 species) |
| Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries) Uniprot P24321 |
| Domain d2hgrt1: 2hgr T:2-105 [136457] Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgrh2, d2hgri1, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrp1, d2hgrq1, d2hgrr1, d2hgrs1, d2hgru1, d2hgrv1, d2hgrw1, d2hgrx1 protein/RNA complex protein/RNA complex has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2hgr (more details), 4.51 Å
SCOPe Domain Sequences for d2hgrt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgrt1 b.40.4.5 (T:2-105) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
Timeline for d2hgrt1: