SCOPe 2.04: Domain d2h6aa_: 2h6a A:

Lineage for d2h6aa_ (2h6a A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (7 species)
   not a true protein

7. Species Stenotrophomonas maltophilia [TaxId:40324] [186946] (2 PDB entries)

8. Domain d2h6aa_: 2h6a A: [136183]
   automated match to d1smla_
   complexed with so4, zn

Details for d2h6aa_

PDB Entry: 2h6a, 1.8 Å

PDB Description: Crystal structure of the zinc-beta-lactamase L1 from Stenotrophomonas maltophilia (mono zinc form)

PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d2h6aa_:

Sequence; same for both SEQRES and ATOM records:

>d2h6aa_ d.157.1.1 (A:) automated matches {Stenotrophomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

Timeline for d2h6aa_:

• d2h6aa_ first appeared in SCOP 1.73, called d2h6aa1
  
• d2h6aa_ appears in SCOPe 2.03
  
• d2h6aa_ appears in SCOPe 2.05
  
• d2h6aa_ appears in the current release, SCOPe 2.08