SCOP 1.73: Domain d2h3eb1: 2h3e B:9-100

Lineage for d2h3eb1 (2h3e B:9-100)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family)

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (2 species)

7. Species Escherichia coli [TaxId:562] [54896] (41 PDB entries)

8. Domain d2h3eb1: 2h3e B:9-100 [136038]
   Other proteins in same PDB: d2h3ea1, d2h3ea2, d2h3eb2, d2h3ec1, d2h3ec2, d2h3ed2
   automatically matched to d1d09b1
   complexed with 6pr, zn

Details for d2h3eb1

PDB Entry: 2h3e, 2.3 Å

PDB Description: structure of wild-type e. coli aspartate transcarbamoylase in the presence of n-phosphonacetyl-l-isoasparagine at 2.3a resolution

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d2h3eb1:

Sequence; same for both SEQRES and ATOM records:

>d2h3eb1 d.58.2.1 (B:9-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
veaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflse
dqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d2h3eb1:

• d2h3eb1 is new in SCOP 1.73
  
• d2h3eb1 appears in SCOP 1.75
  
• d2h3eb1 appears in the current release, SCOPe 2.08