Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (2 families) |
Family c.120.1.1: PIN domain [89619] (7 proteins) Pfam PF01850 |
Protein Trafficking protein B [142110] (1 species) |
Species Neisseria gonorrhoeae [TaxId:485] [142111] (3 PDB entries) |
Domain d2h1oa1: 2h1o A:1-138 [135971] automatically matched to 2BSQ A:1-138 complexed with 5iu; mutant |
PDB Entry: 2h1o (more details), 3 Å
SCOP Domain Sequences for d2h1oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1oa1 c.120.1.1 (A:1-138) Trafficking protein B {Neisseria gonorrhoeae [TaxId: 485]} milldtnviseplrpqpnervvawldsliledvylsaitvaemrlgvalllngkkknvlh ermeqsilplfagrilpfdepvaaiyaqirsyakthgkeiaaadgyiaatakqhsmtvat rdtgsffaadvavfnpwh
Timeline for d2h1oa1: