![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (27 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein Papillomavirus large T antigen helicase domain [89688] (1 species) |
![]() | Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries) |
![]() | Domain d2h1lf1: 2h1l F:266-627 [135952] Other proteins in same PDB: d2h1lm1, d2h1ln1, d2h1lo1, d2h1lp1, d2h1lq1, d2h1lr1, d2h1ls1, d2h1lt1, d2h1lu1, d2h1lv1, d2h1lw1, d2h1lx1 automatically matched to d1svla_ complexed with zn |
PDB Entry: 2h1l (more details), 3.16 Å
SCOP Domain Sequences for d2h1lf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1lf1 c.37.1.20 (F:266-627) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv ld
Timeline for d2h1lf1: