Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.54: Methyltransferase 10 domain [142651] (2 proteins) Pfam PF05971; DUF890 |
Protein automated matches [190671] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187777] (2 PDB entries) |
Domain d2h00c_: 2h00 C: [135927] Other proteins in same PDB: d2h00a1 automated match to d2h00a1 complexed with cl, dtu, sah |
PDB Entry: 2h00 (more details), 2 Å
SCOPe Domain Sequences for d2h00c_:
Sequence, based on SEQRES records: (download)
>d2h00c_ c.66.1.54 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdkstl rrgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkvpqk tllmdalkeeseiiydfcmcnppffanqleakgvnsrnprrpppssvntggiteimaegg elefvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvpkvtytefcqgrtmrw alawsfyd
>d2h00c_ c.66.1.54 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqtlrrgid igtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkvpqktllmd iiydfcmcnppffggelefvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvp kvtytefcqgrtmrwalawsfyd
Timeline for d2h00c_: