Lineage for d2gzhb1 (2gzh B:468-502)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 895780Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) (S)
  5. 895781Family h.1.31.1: Eferin C-derminal domain-like [144271] (2 proteins)
    contains PfamB PB042332, PfamB PB026102
  6. 895782Protein Rab11 family-interacting protein 2 [144272] (1 species)
  7. 895783Species Human (Homo sapiens) [TaxId:9606] [144273] (2 PDB entries)
    Uniprot Q7L804 468-502
  8. 895784Domain d2gzhb1: 2gzh B:468-502 [135906]
    Other proteins in same PDB: d2gzha1
    automatically matched to 2GZD C:468-502
    complexed with gtp, mg, po4; mutant

Details for d2gzhb1

PDB Entry: 2gzh (more details), 2.47 Å

PDB Description: crystal structure of rab11 in complex with rab11-family interacting protein 2
PDB Compounds: (B:) RAB11-FIP2 long isoform

SCOP Domain Sequences for d2gzhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzhb1 h.1.31.1 (B:468-502) Rab11 family-interacting protein 2 {Human (Homo sapiens) [TaxId: 9606]}
rrkdthireledyidnllvrvmeetpsilrvpyep

SCOP Domain Coordinates for d2gzhb1:

Click to download the PDB-style file with coordinates for d2gzhb1.
(The format of our PDB-style files is described here.)

Timeline for d2gzhb1: