SCOPe 2.08: Domain d2gzhb1: 2gzh B:468-502

Lineage for d2gzhb1 (2gzh B:468-502)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family)

5. Family h.1.31.1: Eferin C-derminal domain-like [144271] (3 proteins)
   contains PfamB PB042332, PfamB PB026102

6. Protein Rab11 family-interacting protein 2 [144272] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144273] (2 PDB entries)
   Uniprot Q7L804 468-502

8. Domain d2gzhb1: 2gzh B:468-502 [135906]
   Other proteins in same PDB: d2gzha_
   automatically matched to 2GZD C:468-502
   complexed with gtp, mg, po4

Details for d2gzhb1

PDB Entry: 2gzh, 2.47 Å

PDB Description: crystal structure of rab11 in complex with rab11-family interacting protein 2

PDB Compounds: (B:) RAB11-FIP2 long isoform

SCOPe Domain Sequences for d2gzhb1:

Sequence; same for both SEQRES and ATOM records:

>d2gzhb1 h.1.31.1 (B:468-502) Rab11 family-interacting protein 2 {Human (Homo sapiens) [TaxId: 9606]}
rrkdthireledyidnllvrvmeetpsilrvpyep

Timeline for d2gzhb1:

• d2gzhb1 first appeared in SCOP 1.73
  
• d2gzhb1 appears in SCOPe 2.07