Lineage for d2gwsi1 (2gws I:250-327)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272498Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 1272499Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 1272650Protein DNA polymerase lambda [101251] (1 species)
  7. 1272651Species Human (Homo sapiens) [TaxId:9606] [101252] (17 PDB entries)
  8. 1272676Domain d2gwsi1: 2gws I:250-327 [135819]
    Other proteins in same PDB: d2gwsa2, d2gwsa3, d2gwse2, d2gwse3, d2gwsi2, d2gwsi3, d2gwsm2, d2gwsm3
    automatically matched to d1nzpa_
    protein/DNA complex; complexed with cac, cl, edo, mg, na

Details for d2gwsi1

PDB Entry: 2gws (more details), 2.4 Å

PDB Description: crystal structure of human dna polymerase lambda with a g/g mismatch in the primer terminus
PDB Compounds: (I:) DNA polymerase lambda

SCOPe Domain Sequences for d2gwsi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwsi1 a.60.6.1 (I:250-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
aekiieilesghlrkldh

SCOPe Domain Coordinates for d2gwsi1:

Click to download the PDB-style file with coordinates for d2gwsi1.
(The format of our PDB-style files is described here.)

Timeline for d2gwsi1: