![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Fungal alpha-amylase [51028] (2 species) |
![]() | Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries) |
![]() | Domain d2gvya1: 2gvy A:382-476 [135793] Other proteins in same PDB: d2gvya2, d2gvyb2 automated match to d7taaa1 complexed with ca, nag |
PDB Entry: 2gvy (more details), 1.8 Å
SCOPe Domain Sequences for d2gvya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gvya1 b.71.1.1 (A:382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct tvtvgsdgnvpvpmagglprvlypteklagskics
Timeline for d2gvya1: