Lineage for d2gt9a2 (2gt9 A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937696Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
    Uniprot P01892 25-298
  8. 2937721Domain d2gt9a2: 2gt9 A:1-181 [135625]
    Other proteins in same PDB: d2gt9a1, d2gt9b2, d2gt9b3, d2gt9d1, d2gt9e2, d2gt9e3
    automatically matched to d1akja2
    complexed with gol, na

Details for d2gt9a2

PDB Entry: 2gt9 (more details), 1.75 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the decameric Melan-A/MART-1(26-35) peptide
PDB Compounds: (A:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d2gt9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gt9a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2gt9a2:

Click to download the PDB-style file with coordinates for d2gt9a2.
(The format of our PDB-style files is described here.)

Timeline for d2gt9a2: