Lineage for d2gl5a2 (2gl5 A:1-122)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649015Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1649244Protein Putative dehydratase protein STM2273 [143250] (2 species)
  7. 1649254Species Salmonella typhimurium [TaxId:90371] [143251] (1 PDB entry)
    Uniprot Q8ZNH1 1-122
  8. 1649255Domain d2gl5a2: 2gl5 A:1-122 [135337]
    Other proteins in same PDB: d2gl5a1, d2gl5b1
    complexed with gol, mg

Details for d2gl5a2

PDB Entry: 2gl5 (more details), 1.6 Å

PDB Description: crystal structure of putative dehydratase from salmonella thyphimurium
PDB Compounds: (A:) putative dehydratase protein

SCOPe Domain Sequences for d2gl5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gl5a2 d.54.1.1 (A:1-122) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]}
lkitsievfdcelkkrdqtmssynpvlirvntdsglsgigevglaygagakagvgiirdl
aplivgedplniekiwefffrktfwgmgggnvfyagmsaidialwdikgkylgvpvyqll
gg

SCOPe Domain Coordinates for d2gl5a2:

Click to download the PDB-style file with coordinates for d2gl5a2.
(The format of our PDB-style files is described here.)

Timeline for d2gl5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gl5a1