Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (8 proteins) Pfam PF00567 |
Protein Jumonji domain-containing protein 2A [141203] (1 species) contains tandem repeat of two segment-swapped Tudor domains |
Species Human (Homo sapiens) [TaxId:9606] [141204] (4 PDB entries) Uniprot O75164 897-955! Uniprot O75164 956-1011 |
Domain d2gf7a2: 2gf7 A:897-955 [135082] complexed with so4 |
PDB Entry: 2gf7 (more details), 2.2 Å
SCOPe Domain Sequences for d2gf7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gf7a2 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfg
Timeline for d2gf7a2: