![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Bifidobacterium adolescentis [TaxId:1680] [255184] (4 PDB entries) |
![]() | Domain d2gdua1: 2gdu A:435-504 [135032] Other proteins in same PDB: d2gdua2, d2gdub2 automated match to d1r7aa1 mutant |
PDB Entry: 2gdu (more details), 2.1 Å
SCOPe Domain Sequences for d2gdua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdua1 b.71.1.0 (A:435-504) automated matches {Bifidobacterium adolescentis [TaxId: 1680]} afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd dlianppvva
Timeline for d2gdua1: