Lineage for d2gcla1 (2gcl A:237-474)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323359Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1323360Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1323871Family b.55.1.10: SSRP1-like [141436] (2 proteins)
    Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold
  6. 1323872Protein FACT complex subunit POB3, middle domain [141437] (1 species)
  7. 1323873Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141438] (2 PDB entries)
    Uniprot Q04636 237-474! Uniprot Q04636 238-474
  8. 1323874Domain d2gcla1: 2gcl A:237-474 [134991]
    Other proteins in same PDB: d2gclb_
    complexed with cl

Details for d2gcla1

PDB Entry: 2gcl (more details), 2.21 Å

PDB Description: structure of the pob3 middle domain
PDB Compounds: (A:) Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region

SCOPe Domain Sequences for d2gcla1:

Sequence, based on SEQRES records: (download)

>d2gcla1 b.55.1.10 (A:237-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vagdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihh
mmvmaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthiv
lshvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsd
vsmvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn

Sequence, based on observed residues (ATOM records): (download)

>d2gcla1 b.55.1.10 (A:237-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vagdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihh
mmvmaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthiv
lshvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsd
vsmvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn

SCOPe Domain Coordinates for d2gcla1:

Click to download the PDB-style file with coordinates for d2gcla1.
(The format of our PDB-style files is described here.)

Timeline for d2gcla1: