Class a: All alpha proteins [46456] (285 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c551 [46660] (4 species) |
Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries) |
Domain d2gc7p_: 2gc7 P: [134969] Other proteins in same PDB: d2gc7a_, d2gc7b_, d2gc7c_, d2gc7e_, d2gc7f_, d2gc7g_, d2gc7i_, d2gc7j_, d2gc7k_, d2gc7m_, d2gc7n_, d2gc7o_ automated match to d1mg2d_ complexed with hem, na |
PDB Entry: 2gc7 (more details), 1.9 Å
SCOPe Domain Sequences for d2gc7p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc7p_ a.3.1.1 (P:) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]} apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv rhlytgdpkdaswltdeqkagftpfqp
Timeline for d2gc7p_: