Lineage for d2g9ha1 (2g9h A:83-179)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358644Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2358712Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (31 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2358719Domain d2g9ha1: 2g9h A:83-179 [134802]
    Other proteins in same PDB: d2g9ha2, d2g9hb1, d2g9hb2, d2g9hd1, d2g9hd2
    automatically matched to d1k2da1
    complexed with dio, epe, so4, zn

Details for d2g9ha1

PDB Entry: 2g9h (more details), 2 Å

PDB Description: crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2g9ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g9ha1 b.1.1.2 (A:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

SCOPe Domain Coordinates for d2g9ha1:

Click to download the PDB-style file with coordinates for d2g9ha1.
(The format of our PDB-style files is described here.)

Timeline for d2g9ha1: