SCOPe 2.03: Domain d2g63a1: 2g63 A:39-508

Lineage for d2g63a1 (2g63 A:39-508)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (68 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d2g63a1: 2g63 A:39-508 [134686]
   Other proteins in same PDB: d2g63a2, d2g63b2, d2g63c2, d2g63d2
   automatically matched to d1orva1
   complexed with aaf

Details for d2g63a1

PDB Entry: 2g63, 2 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv (dppiv) complexed with cyanopyrrolidine (c5-pro-pro) inhibitor 24b

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2g63a1:

Sequence; same for both SEQRES and ATOM records:

>d2g63a1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d2g63a1:

• d2g63a1 first appeared in SCOP 1.73
  
• d2g63a1 appears in SCOPe 2.02
  
• d2g63a1 appears in SCOPe 2.04
  
• d2g63a1 appears in the current release, SCOPe 2.08