Lineage for d2g5ta2 (2g5t A:509-764)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1383605Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 1383612Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 1383613Species Human (Homo sapiens) [TaxId:9606] [82499] (68 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 1383674Domain d2g5ta2: 2g5t A:509-764 [134676]
    Other proteins in same PDB: d2g5ta1, d2g5tb1
    automatically matched to d1orva2
    complexed with acf

Details for d2g5ta2

PDB Entry: 2g5t (more details), 2.3 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv (dppiv) complexed with cyanopyrrolidine (c5-pro-pro) inhibitor 21ag
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2g5ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5ta2 c.69.1.24 (A:509-764) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

SCOPe Domain Coordinates for d2g5ta2:

Click to download the PDB-style file with coordinates for d2g5ta2.
(The format of our PDB-style files is described here.)

Timeline for d2g5ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g5ta1